PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA52G00002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 253aa    MW: 28727.2 Da    PI: 6.5178
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA52G00002genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.12.4e-092471347
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47
                      W++eE + + +a + +  +    +W +Ia++++ g++  ++ + ++k+
       AA52G00002 24 QWSKEENKMFEKALAIYTEEdspdRWFKIAEMIP-GKSVVDVMNQYNKL 71
                     7*****************99**************.************97 PP

2Myb_DNA-binding409.2e-13125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
       AA52G00002 125 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 169
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.2932074IPR017884SANT domain
SMARTSM007176.7E-92174IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-112380IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-52471IPR009057Homeodomain-like
PfamPF002491.9E-82471IPR001005SANT/Myb domain
CDDcd001674.27E-92571No hitNo description
PROSITE profilePS5129418.771118174IPR017930Myb domain
SuperFamilySSF466893.37E-15120173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-11122173IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-17122173IPR006447Myb domain, plants
SMARTSM007171.7E-10122172IPR001005SANT/Myb domain
CDDcd001678.12E-9125169No hitNo description
PfamPF002494.0E-10125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
METLQPLSHH FINEDLMNLQ SSSQWSKEEN KMFEKALAIY TEEDSPDRWF KIAEMIPGKS  60
VVDVMNQYNK LEEDVLDIES GRVPIPGYPP ACSSDPLGFE RDVACRKRSN GNSKGCDQER  120
RKGVPWTEEE HRRFLLGLLK YGKGDWRNIS RNFVVSKTPT QVASHAQKYY QRQISGTKDK  180
RRPSIHDITT VNLLNANLMR SSSEFNPDLG FNSDEGMMFS RQNMLSESLF SPSISHFGDA  240
GKFTGENCFG AGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-142188773RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010486776.11e-123PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-71DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4M9401e-121V4M940_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__1170__AT3G11280.11e-120(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-123MYB family protein